Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645688.1 | internal | 265 | 2-796(+) |
Amino Acid sequence : | |||
QIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAA AGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVSES GWPSAGGTATSIDNARTYNQNLINH | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 29,261.739 | ||
Theoretical pI: | 7.974 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33350 33350 | ||
Instability index: | 46.133 | ||
aromaticity | 0.098 | ||
GRAVY | -0.187 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.317 | ||
sheet | 0.189 |