Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645690.1 | internal | 280 | 2-841(+) |
Amino Acid sequence : | |||
RLLALKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA | |||
Physicochemical properties | |||
Number of amino acids: | 280 | ||
Molecular weight: | 31,375.770 | ||
Theoretical pI: | 7.981 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 27.071 | ||
aromaticity | 0.039 | ||
GRAVY | -0.391 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.164 | ||
sheet | 0.239 |