Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645697.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
GLKGPMATPIGKGHRSLNLTLRKELGLYANVRPCYSLQGYKTRYDDVNLVTIRENTEGEYSGLEHQVVRGVVESLKVITRQASLRVAEYAFHYAKTNGRQRVSAIHKANIMRKTDGLFLK CCREVAEKYPDITYEEVIIDNCCMMLVKNPSLFDVLVMPNLYGDIISDLCAGLVGGLGLTPSCNIGEGGIALAEAVHGSAPDIAGKNLANPTALLLSGVMMLRHLKLSDKAEQIHNAIIK TIAEG | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 26,711.735 | ||
Theoretical pI: | 8.427 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14900 15275 | ||
Instability index: | 31.469 | ||
aromaticity | 0.053 | ||
GRAVY | -0.029 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.233 | ||
sheet | 0.290 |