Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645702.1 | internal | 268 | 1-804(+) |
Amino Acid sequence : | |||
NKTTSSPMAATVLLLGLFLASLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSQQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGN EVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNL FDALVDSVYASLEKAGGGGLEIVVSESG | |||
Physicochemical properties | |||
Number of amino acids: | 268 | ||
Molecular weight: | 29,410.212 | ||
Theoretical pI: | 8.624 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 47.770 | ||
aromaticity | 0.093 | ||
GRAVY | -0.031 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.302 | ||
sheet | 0.216 |