Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645709.1 | 3prime_partial | 218 | 27-680(+) |
Amino Acid sequence : | |||
MMVSHLEWRMVSLAILLLLVPRFPATSQVHLANEKRVKSAVFLSPMFVLGPGSVENKYYYNIGFPRGHIFLKEFDAEVIDEEGNPVPLHETYLHHWVVERYYALRDVDISKERGDRKLNR PKILSARNSGVCDDNTLGQYFGLGSETRKTATYVPDPYGIEVGNPAIIPDGYEQRWLLNVHAIDTRGVEDPLGCTECRCDLYNITKDESGRPLSTGYK | |||
Physicochemical properties | |||
Number of amino acids: | 218 | ||
Molecular weight: | 24,788.942 | ||
Theoretical pI: | 5.984 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34630 | ||
Instability index: | 40.733 | ||
aromaticity | 0.101 | ||
GRAVY | -0.349 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.243 | ||
sheet | 0.239 |