Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645720.1 | internal | 262 | 1-786(+) |
Amino Acid sequence : | |||
SDSTAKLDIDLNEGFPVDEGSQVDQVNSVGPGPSSIPPAGPLPFPLSSISSNLPSSVTVAAAAKGRFILPENLTRNKGEIGWKGSAATSAFRPAEPRKVLEMPLATTDPSLDIVAGKQGR PALDIDLNVPDERVLEDLVPHSSAQETGSESGLVSIQKFGHREMVGSSAPFRSAGGLDLDLNRVDEASDVGHLSASTSRRTEVQPLSIRVSSSSGFSNGEVNVLRNFDLNNGPGLDELSV EPAPPRPHPKGNLPFLSPVAGI | |||
Physicochemical properties | |||
Number of amino acids: | 262 | ||
Molecular weight: | 10,240.541 | ||
Theoretical pI: | 6.228 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 48.428 | ||
aromaticity | 0.050 | ||
GRAVY | -0.011 | ||
Secondary Structure Fraction | |||
Helix | 0.240 | ||
turn | 0.340 | ||
sheet | 0.310 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645720.1 | complete | 100 | 374-72(-) |
Amino Acid sequence : | |||
MSNAGRPCFPATISSEGSVVASGISRTFLGSAGLNALVAAEPFQPISPLFLVRFSGRIKRPLAAAATVTEEGRLLDMEERGKGRGPAGGIDEGPGPTELT* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,240.541 | ||
Theoretical pI: | 6.228 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 48.428 | ||
aromaticity | 0.050 | ||
GRAVY | -0.011 | ||
Secondary Structure Fraction | |||
Helix | 0.240 | ||
turn | 0.340 | ||
sheet | 0.310 |