Acc_NO	ORF type	length	start-end position (strand +/-)
>JG645730.1	internal	240	3-722(+)
Amino Acid sequence :
RGISMAPPEDSVEVVEEAGVAEAEKRPISTIVIIIAMQTEALPLVNKFQLIEDQDSVFPKGVPWVRYHGIYKDLFINIIWPGKDPVLGVDSVGTVPASLVTYASIQALQPDLIINAGTAG GFKAKGACIGDVILVSDVAFNDRRIPIPVFDLYGIGARRAFSTPNLLKEFKMKVGKLSTGDSLVMSPQDEAAITANDTTVKDMEGAAVAYVADLLSVPAIFLKAVTDIVDGDKPTAEEFL
Physicochemical properties
Number of amino acids:		240
Molecular weight:		14,730.917
Theoretical pI:		10.207
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 13980
Instability index:		64.516
aromaticity		0.079
GRAVY		0.231
Secondary Structure Fraction
Helix		0.288
turn		0.295
sheet		0.273

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG645730.1	5prime_partial	139	724-305(-)
Amino Acid sequence :
FKNSSAVGLSPSTISVTAFRNIAGTERRSATYATAAPSISFTVVSLAVMAASSWGDITKESPVDNLPTFILNSFRRFGVEKALLAPIPYRSNTGIGILLSLKATSETRITSPMHAPLALK PPAVPAFMIRSGCKAWMDA*
Physicochemical properties
Number of amino acids:		139
Molecular weight:		14,730.917
Theoretical pI:		10.207
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 13980
Instability index:		64.516
aromaticity		0.079
GRAVY		0.231
Secondary Structure Fraction
Helix		0.288
turn		0.295
sheet		0.273