Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645731.1 | 5prime_partial | 138 | 3-419(+) |
Amino Acid sequence : | |||
EVSPQGLGCMGMSAFYGPPKPEPDMIALIHHAIGKGVTFLDTSDLYGPHTNEILLGKALAGGVREKVELATKFGIRSYKEGGQTKMSVQGDPAYVRAACEGSLKRLQVDCIDLYYQHRID TSIPIEVTVSLPPLPLLF* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 11,937.361 | ||
Theoretical pI: | 7.022 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 43.740 | ||
aromaticity | 0.091 | ||
GRAVY | 0.061 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.264 | ||
sheet | 0.255 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645731.1 | complete | 110 | 353-21(-) |
Amino Acid sequence : | |||
MLVIEINTINLKSFQAPFTSSSNIRRITLHAHLGLSSFLVRPDSELGGQLHLLSNAAGKSFAEKYLVGVRTVEVGGVQEGDSFADGVVYQSYHVRFRLWGTVEGGHAHAA* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 11,937.361 | ||
Theoretical pI: | 7.022 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 43.740 | ||
aromaticity | 0.091 | ||
GRAVY | 0.061 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.264 | ||
sheet | 0.255 |