Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645741.1 | internal | 279 | 838-2(-) |
Amino Acid sequence : | |||
QPRHARYCNALVPALEPKSADTSVSPLMALQVTLFPNSGICIGVTVSHVVADGRITTQFIKFWASICRRGGEGGGDQVTVESSSLLPFYDRTVIKDPAGFLISHLNKLREFKKALEVFQS AVSPSPSNDDKLRATFVMGRTEIERLKKWVLRKLNEKNRETSGVTFPLSTFVVTCAYVFTCLVKSRSSSDGDEVSNMRSNKEKAAGKECFLFAVDCRERLDPPIPKMYFGNCLLACIVEF EESDLTGDEGIAIVAEAIGRDVQRMNGESVMKRAENFLT | |||
Physicochemical properties | |||
Number of amino acids: | 279 | ||
Molecular weight: | 10,941.692 | ||
Theoretical pI: | 10.299 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 72.086 | ||
aromaticity | 0.078 | ||
GRAVY | 0.321 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.304 | ||
sheet | 0.235 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645741.1 | 5prime_partial | 102 | 3-311(+) |
Amino Acid sequence : | |||
VKKFSALFITLSPFILCTSLPIASATIAIPSSPVKSLSSNSTIQASRQFPKYIFGIGGSKRSLQSTAKRKHSFPAAFSLLLLILLTSSPSDELLDLTKQVNT* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 10,941.692 | ||
Theoretical pI: | 10.299 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 72.086 | ||
aromaticity | 0.078 | ||
GRAVY | 0.321 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.304 | ||
sheet | 0.235 |