Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645754.1 | internal | 254 | 1-762(+) |
Amino Acid sequence : | |||
VDASGGTPCGNYCTLCYMAISHSHARSPFLPEILEFPAKPFTSRPTIFFNRLCKTLTIRAVLSQKPAAAAAAAAANPPAKNFQHCFSKPEDGYLYCEGVRVQDIIDSVEKRPFYLYSKPQ ITRNFIAYRDALQGLQSAIIGYAIKANNNLKILEHLRQLGSGAVLVSGNELRLALQAGFDPTKCIFNGNGKFLEDLVLAAQKGVFVNVDSEFDLGNIVEAARIVGKKVNVLLRINPDVDP QVHPYVATGNKNSK | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 27,742.599 | ||
Theoretical pI: | 9.027 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13785 | ||
Instability index: | 38.997 | ||
aromaticity | 0.091 | ||
GRAVY | -0.056 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.252 | ||
sheet | 0.248 |