Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645764.1 | 3prime_partial | 261 | 1-783(+) |
Amino Acid sequence : | |||
MKPVLLSLSMNLSLTLFLLSSLLIYNGYAWKKPFHPLDVLPLLPKEVSWPILNNLRSAVDLLPSFVGTASSSQDALEWKGACFYKNRAWMEFHNKSGSEFGGGTLHLKASDAHSWTCMDL YLFATPYRVTWDYYFLAREHTLEFKEWEGKEEYEYVKNKGVSIFLMESGLLGTLRALWDVFPLFTNTGWGESSNLAFLEKHMKASFEKRPQPWVTNVSVDDLHSGDFIAISKIRGRWGGF ETLEKWVTGAYAGHTAVLLKD | |||
Physicochemical properties | |||
Number of amino acids: | 261 | ||
Molecular weight: | 29,776.803 | ||
Theoretical pI: | 6.454 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 80900 81025 | ||
Instability index: | 28.144 | ||
aromaticity | 0.146 | ||
GRAVY | -0.118 | ||
Secondary Structure Fraction | |||
Helix | 0.364 | ||
turn | 0.241 | ||
sheet | 0.295 |