Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645770.1 | 3prime_partial | 214 | 62-703(+) |
Amino Acid sequence : | |||
MAGGKIRKEKPSRAASNHYQGGVTFHKSKGQHILKNPLLIDTIIQKSGIKDTDIILEIGPGTGNLTSKLLQVGKSVIAVELDPRMVLELQRRFQGTPFSNKLKVIQGDVLKTDLPYFDIC VANIPYQISSPLTFKLLSHRPAFRCAVIMFQREFAMRLVAQPGQNLYCRLSVNTQLLARVSHLLKVGKNNFRPPPKVDSSVVRIEPRKPLPPVD | |||
Physicochemical properties | |||
Number of amino acids: | 214 | ||
Molecular weight: | 23,884.831 | ||
Theoretical pI: | 10.159 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 32.396 | ||
aromaticity | 0.061 | ||
GRAVY | -0.177 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.252 | ||
sheet | 0.206 |