Acc_NO	ORF type	length	start-end position (strand +/-)
>JG645771.1	internal	208	1-624(+)
Amino Acid sequence :
RRLIKGGIMPAGGFTGPKSGGVEFEAKITPVVIISCIMAATGGLMFGYDVGVSGGVTSMDHFLVKFFPVVYRKKHEPGIDSNYCKYDNQGLQLFTSSLYLAGLTSTFFASYTTRKLGRRL TMLIAGVFFIIGVVLNAAAINLLMLIIGRILLGCGVGFANQAVPLFLSEIAPTRIRGGLNILFQLNVTIGILFANLVNYGTNKIKGGW
Physicochemical properties
Number of amino acids:		208
Molecular weight:		22,322.209
Theoretical pI:		9.876
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15930 16055
Instability index:		33.299
aromaticity		0.111
GRAVY		0.585
Secondary Structure Fraction
Helix		0.399
turn		0.269
sheet		0.231