Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645800.1 | 3prime_partial | 225 | 64-738(+) |
Amino Acid sequence : | |||
MPIESSIPTPLGPAACEKDAKALQFIEEMTINADPVQEKVLAEILSRNAKTEYLRRYHLDGATDRHNFKSKVPVITYEDLQPEIQRIANGDRTSILSADPISEFLTSSGTSAGERKLMPT IQEELDRRQVLYSLLMPVMNLYVPGLDKGKGLYFLFIKSETKTPGGLVARPVLTSYYKSDHFKARPYDPYMVYTSPNEAILCTDSYQSMYTQMFCGLYHREEVLR | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 25,559.986 | ||
Theoretical pI: | 5.866 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20860 20985 | ||
Instability index: | 61.646 | ||
aromaticity | 0.093 | ||
GRAVY | -0.379 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.222 | ||
sheet | 0.276 |