Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645805.1 | internal | 288 | 3-866(+) |
Amino Acid sequence : | |||
KTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNE VSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLF DALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNARTLHQNL | |||
Physicochemical properties | |||
Number of amino acids: | 288 | ||
Molecular weight: | 31,471.469 | ||
Theoretical pI: | 8.625 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31860 31860 | ||
Instability index: | 46.413 | ||
aromaticity | 0.090 | ||
GRAVY | -0.049 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.302 | ||
sheet | 0.219 |