Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645808.1 | internal | 273 | 1-819(+) |
Amino Acid sequence : | |||
FNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVG NEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRN LFDALVDSVYASLEKAGGGGLEIVVSESGWPSA | |||
Physicochemical properties | |||
Number of amino acids: | 273 | ||
Molecular weight: | 29,981.879 | ||
Theoretical pI: | 8.624 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31860 31860 | ||
Instability index: | 49.140 | ||
aromaticity | 0.099 | ||
GRAVY | -0.019 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.304 | ||
sheet | 0.216 |