Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645815.1 | internal | 286 | 1-858(+) |
Amino Acid sequence : | |||
ARSSLIRGESLRVFSFKFRVRAMASHIVGYPRTGPKRELKFALESFWDGKSSAEDLEKVSADLRSSIWKQMADAGIKYIPSNTFSHYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMA RGNAAVPAMEMTKWFDTNYHFIVPELGPDTKFSYASHKAVNEYNEAKAFGVDTVPVLVGPVSYLLLSKHAKGTDKSFSLLSLLGSILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSEK LKAFTAAYSELESTLSGVNVVIETYFADVPAEAYKTLTSLKGVTGF | |||
Physicochemical properties | |||
Number of amino acids: | 286 | ||
Molecular weight: | 31,526.488 | ||
Theoretical pI: | 6.018 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46870 46870 | ||
Instability index: | 29.581 | ||
aromaticity | 0.122 | ||
GRAVY | -0.063 | ||
Secondary Structure Fraction | |||
Helix | 0.332 | ||
turn | 0.234 | ||
sheet | 0.280 |