Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645818.1 | internal | 269 | 2-808(+) |
Amino Acid sequence : | |||
SIVAVTVFPRFNLLLIDMARKFFVGGNWKCNGTTEEVKKIVSVLNEAEVPSEDVVEVVVSPPFVFLPIVKSLLRSDFQVAAQNCWVRKGGAFTGEVSAEMLVNLGIPWVILGHSERRQLL GESNEFVGDKVAYALAQGLKVIACIGETLEQRESGSTMEVVAAQTKAIADQVSNWANVVLAYEPVWAIGTGKVATPAQAQEVHFELRKWIHSNVGAEVAATTRIIYGGSVNGANCKELAA QPDVDGFLVGGASLKPEFVDIIKSATVKS | |||
Physicochemical properties | |||
Number of amino acids: | 269 | ||
Molecular weight: | 28,927.924 | ||
Theoretical pI: | 5.372 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37720 | ||
Instability index: | 20.954 | ||
aromaticity | 0.078 | ||
GRAVY | 0.228 | ||
Secondary Structure Fraction | |||
Helix | 0.349 | ||
turn | 0.227 | ||
sheet | 0.271 |