Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645820.1 | internal | 244 | 3-734(+) |
Amino Acid sequence : | |||
RYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDIVAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYQGNVEATGEDFSVEP TDTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDDKQLDAEVHRKYIFGGHITSYMQTLMEDEPEKYQSHFSEYIKKGIEPEGMEEMFKKVHAAIRAGPTIKK VEKH | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 27,843.523 | ||
Theoretical pI: | 9.416 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19370 19370 | ||
Instability index: | 31.145 | ||
aromaticity | 0.098 | ||
GRAVY | -0.574 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.176 | ||
sheet | 0.258 |