Acc_NO	ORF type	length	start-end position (strand +/-)
>JG645820.1	internal	244	3-734(+)
Amino Acid sequence :
RYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDIVAQIISASIAGDLVLAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDDEYQGNVEATGEDFSVEP TDTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDDKQLDAEVHRKYIFGGHITSYMQTLMEDEPEKYQSHFSEYIKKGIEPEGMEEMFKKVHAAIRAGPTIKK VEKH
Physicochemical properties
Number of amino acids:		244
Molecular weight:		27,843.523
Theoretical pI:		9.416
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19370 19370
Instability index:		31.145
aromaticity		0.098
GRAVY		-0.574
Secondary Structure Fraction
Helix		0.291
turn		0.176
sheet		0.258