Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645836.1 | internal | 167 | 1-501(+) |
Amino Acid sequence : | |||
KKHNKKTTIMTVSTAPAETSSQEAALLLQVVDEEEHEYCNKAENSSTVVDYKGGKAKKSTTGGWRSASFIMFSAMAERIAYSGISANLITYLTGPLGQSTAAASENVNTWVGVASMLPLV GAFVADAYLGRYRTLLFAFLLYVLWHLRLGAKEIVSNLKATTLLAIL | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 18,054.572 | ||
Theoretical pI: | 8.973 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
Instability index: | 31.434 | ||
aromaticity | 0.090 | ||
GRAVY | 0.135 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.216 | ||
sheet | 0.335 |