Acc_NO	ORF type	length	start-end position (strand +/-)
>JG645836.1	internal	167	1-501(+)
Amino Acid sequence :
KKHNKKTTIMTVSTAPAETSSQEAALLLQVVDEEEHEYCNKAENSSTVVDYKGGKAKKSTTGGWRSASFIMFSAMAERIAYSGISANLITYLTGPLGQSTAAASENVNTWVGVASMLPLV GAFVADAYLGRYRTLLFAFLLYVLWHLRLGAKEIVSNLKATTLLAIL
Physicochemical properties
Number of amino acids:		167
Molecular weight:		18,054.572
Theoretical pI:		8.973
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26930 26930
Instability index:		31.434
aromaticity		0.090
GRAVY		0.135
Secondary Structure Fraction
Helix		0.323
turn		0.216
sheet		0.335