Acc_NO	ORF type	length	start-end position (strand +/-)
>JG645839.1	internal	256	3-770(+)
Amino Acid sequence :
IDLKSKFFELTFNAMMSMVTGQPIGEGLLDSEDNKWFFAILKDTHVPSLFMGPGDYLQVLRWFDVFKIEKALSGLSKKRDVFLDEMIDKYRKRKMENTSGSGNLDGGDDRKKSILDVFFS LQQKDPEQFSDMIIKGMIVTMFTAGTDTSALTLEWAVSLLLNHPEKLQKALSEIDDNVKPGHIIEDSDLAKLPYLHSIILETLRLYPPVPFLVPHESSRECQVGKYDVPKGTVLVANAWA IHRDPKVWADPSKFMP
Physicochemical properties
Number of amino acids:		256
Molecular weight:		14,074.136
Theoretical pI:		8.691
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12740
Instability index:		46.561
aromaticity		0.110
GRAVY		0.183
Secondary Structure Fraction
Helix		0.323
turn		0.331
sheet		0.197

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG645839.1	complete	127	550-167(-)
Amino Acid sequence :
MWPGLTLSSISERAFCSFSGWFSRSDTAHSRVRADVSVPAVNMVTIMPLIIMSENCSGSFCCSEKNTSSIDFFRSSPPSKLPDPEVFSIFLFLYLSIISSKNTSLFLLSPDKAFSILKTS NHLKTCK*
Physicochemical properties
Number of amino acids:		127
Molecular weight:		14,074.136
Theoretical pI:		8.691
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12740
Instability index:		46.561
aromaticity		0.110
GRAVY		0.183
Secondary Structure Fraction
Helix		0.323
turn		0.331
sheet		0.197