Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645855.1 | 5prime_partial | 137 | 1-414(+) |
Amino Acid sequence : | |||
RSEKKKMANEAAPQVGEEKTNSGSIEVSGLQFAYDGQPPLFANFNLNVSPGSRCLLVGANGAGKTTLLKILAGKHMVGGRDVVQVLSCSAFHDTQLVCSGDLVYLGGSWSKTIGSAGEVP LQGDFSAEHMIFGVANA* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 13,634.820 | ||
Theoretical pI: | 6.181 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 63.165 | ||
aromaticity | 0.086 | ||
GRAVY | -0.021 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.147 | ||
sheet | 0.284 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645855.1 | complete | 116 | 407-757(+) |
Amino Acid sequence : | |||
MHKVSDGQRRRVQICMGLLHPFKVLLLDEVTVDLDVVARMDLLEFFKEECEQVRPSTLLGSYEILIYLSTTSTCFEILVFSCREEQLLSMQHIYLMGWRHGPQIWHTSKMASCRDR* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 13,634.820 | ||
Theoretical pI: | 6.181 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 63.165 | ||
aromaticity | 0.086 | ||
GRAVY | -0.021 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.147 | ||
sheet | 0.284 |