Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645870.1 | 5prime_partial | 221 | 3-668(+) |
Amino Acid sequence : | |||
KDLPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYHASMQKGSTAESGNIEAENDENDSVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK LLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERFALS* | |||
Physicochemical properties | |||
Number of amino acids: | 221 | ||
Molecular weight: | 24,144.300 | ||
Theoretical pI: | 5.532 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
Instability index: | 26.554 | ||
aromaticity | 0.059 | ||
GRAVY | -0.195 | ||
Secondary Structure Fraction | |||
Helix | 0.312 | ||
turn | 0.208 | ||
sheet | 0.267 |