Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645894.1 | internal | 241 | 2-724(+) |
Amino Acid sequence : | |||
LVPPLALNPLKEPFLQCSTSRTSLLSMPIYTPENISFSSILQTSAKNLRFLTPTTPKPLLIVTPLDETHVQAAVTCSQKLGLQMRIRSGGHDYEGLSYVSHVPFVIVDLNNFDSVTVDLE KGTAWIGAGATVGQAYYKIAQVSPIHAIPAALCPTVGAGGQFGGGGYGSLMRKYGLAGDNIIDARMVNANGEILTRETMGEDLFWAIRGGGASSFGVVLSWKIKLVAVPPTVTVFTIAKT L | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 10,649.614 | ||
Theoretical pI: | 10.681 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 47.953 | ||
aromaticity | 0.060 | ||
GRAVY | 0.282 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.300 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645894.1 | 5prime_partial | 100 | 723-421(-) |
Amino Acid sequence : | |||
KVLAIVKTVTVGGTATNLIFHDRTTPKLDAPPPLMAQNKSSPIVSLVRISPLAFTIRASMILSPARPYFLIKLPYPPPPNCPPAPTVGHRAAGMAWIGLT* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,649.614 | ||
Theoretical pI: | 10.681 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 47.953 | ||
aromaticity | 0.060 | ||
GRAVY | 0.282 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.300 | ||
sheet | 0.240 |