Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645896.1 | internal | 260 | 1-780(+) |
Amino Acid sequence : | |||
LDARIVNIDGKIMNKDSMGQELFWAIRGGGGASFGIVLSWKIKLVPVPPTVTVFRIQRTLEEGATALVHKWQYIAHKLPKDLTIIGVVRKVNAKEAGKKTIQVSFSSLFLGLTKQLLPII EQSFPELGLKREDCTEISWRQSVPFFAGVSINSSLSDLAINQQKMVFKAKLDYVKEPIPEIVFKKMWKMFLEVDVPGITLIPYGGRMSEIPDSEIPFPHRAGNIFHIGYYVFLNQKEGTA ASKKNIDWIRRLYKYMTPYV | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 13,151.178 | ||
Theoretical pI: | 10.230 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 55.308 | ||
aromaticity | 0.168 | ||
GRAVY | -0.214 | ||
Secondary Structure Fraction | |||
Helix | 0.411 | ||
turn | 0.234 | ||
sheet | 0.131 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645896.1 | 5prime_partial | 107 | 780-457(-) |
Amino Acid sequence : | |||
NIRRHILVQPSNPIYILFGCCGPFFLIQKHIITNVENISSSMWKWNFRIWNLTHPSSIWNEGNARNIYFKKHFPHFFKHNFRNRLLHIVQFRLEDHFLLIYCQITQR* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 13,151.178 | ||
Theoretical pI: | 10.230 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 55.308 | ||
aromaticity | 0.168 | ||
GRAVY | -0.214 | ||
Secondary Structure Fraction | |||
Helix | 0.411 | ||
turn | 0.234 | ||
sheet | 0.131 |