Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645898.1 | internal | 248 | 2-745(+) |
Amino Acid sequence : | |||
SDEIASHYDRTQELKAFDETKAGVRGLVEDGVIKVPRIFINPPDGIHEKMIPGEKIIPVIDLEGVNKGKDVDRRKEIINQVRHAAETWGFFQVENHGIPVEIMDEINEAIREFNEQPREE RRKFYTRDRSRKVIYNSNFDLYESPAANWRDSIGFIVAPNCPSPEDLPLAFRSILMEYSKHVMELGIVLFELLSEALGLNGNHLNEMGCSEGLLFLGHYYPPCPQPELTIGTPKHSDNDF LTILLQDS | |||
Physicochemical properties | |||
Number of amino acids: | 248 | ||
Molecular weight: | 28,302.714 | ||
Theoretical pI: | 4.974 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
Instability index: | 47.125 | ||
aromaticity | 0.085 | ||
GRAVY | -0.440 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.246 | ||
sheet | 0.254 |