Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645906.1 | 3prime_partial | 265 | 23-817(+) |
Amino Acid sequence : | |||
MSVTSIPAMGLLLLCCWAAMVDAEYMKYKDPKQPLNTRIKDLMARMTLEEKIGQMVQIERSVASADVMKKYFIGSVLSGGGSVPAPRASAETWIKMVNEFQRGSLSTRLGIPMIYGIDAV HGHNNVYNATIFPHNVGLGATRDPHLLKKIGAATALEVRATGIPYTFAPCIAVCRDPRWGRCYESYSEDPKIVQAMTDIIPGLQGDLPAGSRKGVPFVGGSKKVAACAKHYVGDGGTTKG INENNTVINENGLFSIHMPAYHNSI | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 28,686.947 | ||
Theoretical pI: | 8.957 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31775 | ||
Instability index: | 32.860 | ||
aromaticity | 0.072 | ||
GRAVY | -0.072 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.264 | ||
sheet | 0.245 |