Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645908.1 | internal | 280 | 1-840(+) |
Amino Acid sequence : | |||
QNQKQNQSVSMSATSFSNGASVFANIVRAPEDPILGVTVAYNKDPSPIKLNLGVGAYRTEEGKPLVLNVVRKAEQLLVNDRSRVKEYLPITGLADFNKLSAKLILGADSPAIQENRVATV QCLSGTGSLRVGAEFLARHYHQHTIYIPQPTWGNHPKVFTLAGLSVKYYRYYDPATRGLDFQGLMEDLGSAPSGAIVLLHACAHNPTGVDPTLEQWDHIRQLMRSKSLLPFFDSAYQGFA SGSLDADAQSVRMFVADGGECFAAQSYAKNMGLYGERVGA | |||
Physicochemical properties | |||
Number of amino acids: | 280 | ||
Molecular weight: | 30,452.131 | ||
Theoretical pI: | 7.876 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 41.280 | ||
aromaticity | 0.089 | ||
GRAVY | -0.197 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.264 | ||
sheet | 0.261 |