Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645915.1 | internal | 281 | 1-843(+) |
Amino Acid sequence : | |||
LVKRVDLRRIGAVGVCKILSSRFRLIGFRFKMDTFFLSHGSPMLAIDDELPARGFLKSWERKVLGEKPSAILMVSAHWDTADPSVNLVKHNDTIHDFYGFPKPMYQLKYPAPGAPKLAAR VKELLSQSGFRNVKEDKARGLDHGAWVPLMLMYPDADVPVCQLSVQSSRDGTYHYNMGRALAPLREEGVLIIGSGSATHNLRIIGTNNGSILPWASEFDSWLKESLINGRYEDINHYEEK APHAKMAHPWPEHFYPLHVALGAAGEDAKAELIHHSWEGGS | |||
Physicochemical properties | |||
Number of amino acids: | 281 | ||
Molecular weight: | 31,433.643 | ||
Theoretical pI: | 7.964 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 51910 52035 | ||
Instability index: | 41.573 | ||
aromaticity | 0.096 | ||
GRAVY | -0.289 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.253 | ||
sheet | 0.278 |