Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645933.1 | internal | 222 | 2-667(+) |
Amino Acid sequence : | |||
LLLALFLASLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSQQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVP FVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANN | |||
Physicochemical properties | |||
Number of amino acids: | 222 | ||
Molecular weight: | 24,724.002 | ||
Theoretical pI: | 9.267 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23380 | ||
Instability index: | 46.650 | ||
aromaticity | 0.099 | ||
GRAVY | -0.084 | ||
Secondary Structure Fraction | |||
Helix | 0.360 | ||
turn | 0.297 | ||
sheet | 0.203 |