Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645942.1 | internal | 271 | 3-815(+) |
Amino Acid sequence : | |||
SLIRGESLRVFSFKFRVRALASHIVGYPRTGPKRELKFALESFWDGKSSAEDLEKVSADLRSSIWKQMADAGIKYIPSNTFSHYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGN AAVPAMEMTKWFDTNYHFIVPELGPDTKFSYASHKAVNEYNEAKAFGVDTVPVLVGPVSYLLLSKHAKGTDKSFSLLSLLGSILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSEKLKA FTAAYSELESTLSGVNVVIETYFADVPAEAY | |||
Physicochemical properties | |||
Number of amino acids: | 271 | ||
Molecular weight: | 29,960.652 | ||
Theoretical pI: | 5.457 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46870 46870 | ||
Instability index: | 29.131 | ||
aromaticity | 0.125 | ||
GRAVY | -0.058 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.232 | ||
sheet | 0.284 |