Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645948.1 | internal | 232 | 3-698(+) |
Amino Acid sequence : | |||
IGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAAA GLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGL | |||
Physicochemical properties | |||
Number of amino acids: | 232 | ||
Molecular weight: | 25,749.030 | ||
Theoretical pI: | 8.970 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 47.945 | ||
aromaticity | 0.103 | ||
GRAVY | -0.134 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.310 | ||
sheet | 0.190 |