Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645957.1 | internal | 277 | 2-832(+) |
Amino Acid sequence : | |||
FRFRSFSCLMEKGGGGGLALAIDSDTIGGFLATKQTPLMSSFLDHHHHQATTSNSHFKRKLDLLDCAPVNTTSSTATTTKFPGLDFSMSLNCGEDDRVFSGSLNSESKRAVVGEMDFFSD KRIKSNGFESKFVGTKKENFDVNTGLNLLTANSASDQSTVEDALMSSTMEDRKRKSELAVLQAELDRMNEENQKLKAMLTQVNNNYNTLQMHILTLMQQQERKSQMIEAGKVEEADKKHL HDQGGINNGGSMVPRQFLDLRPASSIPDTDEPSQSSS | |||
Physicochemical properties | |||
Number of amino acids: | 277 | ||
Molecular weight: | 12,469.777 | ||
Theoretical pI: | 11.731 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 55.628 | ||
aromaticity | 0.075 | ||
GRAVY | 0.204 | ||
Secondary Structure Fraction | |||
Helix | 0.421 | ||
turn | 0.196 | ||
sheet | 0.224 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG645957.1 | complete | 107 | 637-314(-) |
Amino Acid sequence : | |||
MHLKSVVVVVHLGKHRFQLLIFFVHPIKLSLKNSQLALSFPVFHGRRHQRIFYSRLITGRVCSQKIQSSINIEILLLGTNKLALKTIRLNSLIREEIHLTHNRPFTL* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 12,469.777 | ||
Theoretical pI: | 11.731 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 55.628 | ||
aromaticity | 0.075 | ||
GRAVY | 0.204 | ||
Secondary Structure Fraction | |||
Helix | 0.421 | ||
turn | 0.196 | ||
sheet | 0.224 |