Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646019.1	3prime_partial	227	102-782(+)
Amino Acid sequence :
MPEIEEQEHDAGANAALPVKNILFGKYELGKLLGCGAFAKVYHARNLQSGQSVAIKAISKQKVLKSGLTSHIKREICIMRRLRHPNIVKLIEVLASKTKIFFVMEFVKGGELFSKVAKGR FSEDLSRRYFQQLISAVEYCHSHGVFHRDLKPENLLLDENGDLKVSDFGLSAITDEQIRNDGLLHTLCGTPAYVAPEILAKQGYDGAKVDIWSCGVILFVMNAGYLP
Physicochemical properties
Number of amino acids:		227
Molecular weight:		11,005.153
Theoretical pI:		10.577
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12615
Instability index:		61.969
aromaticity		0.047
GRAVY		-0.708
Secondary Structure Fraction
Helix		0.121
turn		0.514
sheet		0.187

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646019.1	3prime_partial	117	353-3(-)
Amino Acid sequence :
MAQATHDADFAFDVRSESGFEDFLLADGFNGDALAGLEVPGVIDLGKGAAAEEFPELVFPEKDILDGKGCIGARIMFLFLDLWHWDQRSTTLRFDQGDFVKKKRDSLFLRFFFSFLF
Physicochemical properties
Number of amino acids:		117
Molecular weight:		11,005.153
Theoretical pI:		10.577
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12615
Instability index:		61.969
aromaticity		0.047
GRAVY		-0.708
Secondary Structure Fraction
Helix		0.121
turn		0.514
sheet		0.187

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646019.1	complete	107	127-450(+)
Amino Acid sequence :
MMRAPMQPFPSRISFSGNTSSGNSSAAAPLPRSITPGTSNPAKASPLKPSASKKSSNPDSLLTSNAKSASCVACAIQTSSNSSKSWPPKPRSSSSWSSSKAENYSPK*
Physicochemical properties
Number of amino acids:		107
Molecular weight:		11,005.153
Theoretical pI:		10.577
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12615
Instability index:		61.969
aromaticity		0.047
GRAVY		-0.708
Secondary Structure Fraction
Helix		0.121
turn		0.514
sheet		0.187