Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646021.1 | internal | 263 | 2-790(+) |
Amino Acid sequence : | |||
AQSVGQLREVSNKVNNAELKLFLEVELGPDLHPIPPPDKTKEDILLFFKLYDPVKEELRYVGRLFVKSSGKPAEILTKLNEMAGFDPNEEIELYEEIKFEPSVMCEHIDKRLTFRASQLE DGDIICFQKSPPTESEEQCRYPEVPLFLEYVHNRQIVHFRSLERPKEDDFCLELSKLSSYDEVVERVAQQLGLDDPSKIRLTPHNCYSQQPKPQPIKYRGMDHLSDMLVHYNQTSDILYY EVLDIPLPELQGLKTLKVAFHHA | |||
Physicochemical properties | |||
Number of amino acids: | 263 | ||
Molecular weight: | 30,555.497 | ||
Theoretical pI: | 5.078 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16390 16640 | ||
Instability index: | 50.849 | ||
aromaticity | 0.087 | ||
GRAVY | -0.522 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.205 | ||
sheet | 0.281 |