Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646030.1 | internal | 235 | 2-706(+) |
Amino Acid sequence : | |||
NQQAVMMGLMLHANAKHLIKHEKYKDALDVLKMGEEAFSLCDSKLIERIDNVSILQIDTVWCYFMLRDITLISMAGVRLTKARDGLARSYKKAQQDSYPEISLYMKLELLEGVVAYHSSK FEMSKRALDSAQARYMQLQVPDEALSLLMSMGYKEQQSKRALRINNQDVERAVAFLVEEKEKSAWRRKEDIRRRKEIKEQRQYGTTPQNKAVDLQRLNELESIGFEREVAAEALR | |||
Physicochemical properties | |||
Number of amino acids: | 235 | ||
Molecular weight: | 27,293.212 | ||
Theoretical pI: | 8.902 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24535 | ||
Instability index: | 56.770 | ||
aromaticity | 0.068 | ||
GRAVY | -0.523 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.145 | ||
sheet | 0.349 |