Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646040.1	5prime_partial	259	1-780(+)
Amino Acid sequence :
LVRGIIEEHRAVHGGSGSGDNGYELTDESDFVDVLLSLDGEGKLNEEDMISILWEMIFRGTDTMGILTEWIMAELILNPNIQAKLQNELDSVVANNHDITDAVVTNLPYLQAVVKETLRV HPPGPLLSWARLSTSDVKLGNGMLIPSNTTAMVNMWAITHDPNLWEDPMVFKPERFLESEGGVNVDVRGNDLRLAPFGAGRRVCPGKNLGLVTVTMWVAKLVQHFKWVEDSEMPVDLSEQ MKLACEMKTPLTAIAIARK*
Physicochemical properties
Number of amino acids:		259
Molecular weight:		19,620.646
Theoretical pI:		10.226
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8855
Instability index:		54.740
aromaticity		0.060
GRAVY		0.302
Secondary Structure Fraction
Helix		0.304
turn		0.304
sheet		0.245

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646040.1	5prime_partial	184	809-255(-)
Amino Acid sequence :
PLLKSPVPFIYLRAIAIAVRGVFISQANFICSLRSTGISESSTHLKCCTNLATHMVTVTRPRFLPGHTLRPAPNGASLRSLPLTSTLTPPSLSKNLSGLNTIGSSQRLGSCVIAHMFTIA VVLDGMSIPLPSFTSEVESLAHERRGPGGCTLRVSLTTACRYGRLVTTASVMSWLFATTESSSF*
Physicochemical properties
Number of amino acids:		184
Molecular weight:		19,620.646
Theoretical pI:		10.226
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8855
Instability index:		54.740
aromaticity		0.060
GRAVY		0.302
Secondary Structure Fraction
Helix		0.304
turn		0.304
sheet		0.245