Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646050.1 | internal | 252 | 3-758(+) |
Amino Acid sequence : | |||
ARKVEAAKVSNVVDYIPAISVSDSSLKSTHVLYNLSPAELYEQAIKYEKGSFITSTGALATLSGAKTGRSPRDKRVVRDEATEDELWWGKGSPNIEMDEHTFLVNRERAVDYLNSLDKVF VNDQFLNWDPEHRIKVRIVSARAYHSLFMHNMCIRPTPEELEDFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGK DGDVALFFGLSG | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 28,473.017 | ||
Theoretical pI: | 6.490 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32890 33015 | ||
Instability index: | 39.531 | ||
aromaticity | 0.099 | ||
GRAVY | -0.347 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.238 | ||
sheet | 0.254 |