Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646065.1 | internal | 267 | 3-803(+) |
Amino Acid sequence : | |||
STLSGVNVVIETYFADVPAEAYKTLTSLKGVTGFGFDLVRGLKTLDLIKGGFPSGKYLFAGVVDGRNIWANDLAASLSTLEALEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSW LAFAAQKVVEVNALARALSGQKDKEYFAANAAAQASRRSSPRVTNEAVQKAAAALKGSDHRRATNVSERLDAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKAKKISEDDYIKAIKDE IAKVVKIQEELDIDVLVHGEPERNDMV | |||
Physicochemical properties | |||
Number of amino acids: | 267 | ||
Molecular weight: | 29,100.859 | ||
Theoretical pI: | 7.725 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 33.224 | ||
aromaticity | 0.060 | ||
GRAVY | -0.176 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.191 | ||
sheet | 0.292 |