Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646072.1 | 3prime_partial | 234 | 109-810(+) |
Amino Acid sequence : | |||
MRIPSCFSGNPSSPTCKSKFQMPQNLITSIYLTHLFNTPTYLTLTWSKTLHSHSLTIIASDSSFSITISLQPSSFSFLLSPRHRRRLAGSKTISLGHTNHHHHKVLSVFWDFTRAKFSKN SAEPDSCFYLAISCNSIIQFFLGDLHDEASRRSKGAGIRECLPPAKLLSRREHVFGKKSYGTRAKFLGSESHEIGIECSGGELKVKVDGEVGLIVKRLGWKFRGNERLMVGGSD | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 26,116.645 | ||
Theoretical pI: | 9.799 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22835 | ||
Instability index: | 48.918 | ||
aromaticity | 0.094 | ||
GRAVY | -0.270 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.295 | ||
sheet | 0.197 |