Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646093.1	internal	214	2-643(+)
Amino Acid sequence :
ERKMSVTSIPAMGLLLLCCWAAMVDAEYMKYKDPKQPLNTRIKDLMARMTLEEKIGQMVQIERSVASADVMKKYFIGSVLSGGGSVPAPRASAETWIKMVNEFQRGSLSTRLGIPMIYGI DAVHGHNNVYNATIFPHNVGLGATRDPHLLKKIGAATALEVRATGIPYTFAPCIAVCRDPRWGRCYESYSEDPKIVQAMTDIIPGLQGDLPAGS
Physicochemical properties
Number of amino acids:		214
Molecular weight:		23,418.051
Theoretical pI:		8.791
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		28420 28670
Instability index:		30.535
aromaticity		0.070
GRAVY		-0.058
Secondary Structure Fraction
Helix		0.285
turn		0.238
sheet		0.271