Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646094.1 | 3prime_partial | 267 | 21-821(+) |
Amino Acid sequence : | |||
MEFLHWFYLFSSLLFLTKFLFGTRKHYPPSPAGAIPIVGHLRLVFTPLHRTLQTLSQRYGQYLFLRLGSRRVLVLSSPAAIEECINKNDLAFANRPRTVAGDYLSYNYTVLALSNYNQLW RNLRRITTNEIFSSASLQASSSVRRDAVRCLLRELCRTTSRSSGAGPVPGQEIKIDLKSKFFELTFNAMMSMVTGQPIGEGLLDSEDNKWFFAILKDTHVPSLFMGPGDYLQVLRWFDVF KIEKALSGVSKKRDVFLDEMIDKYRKR | |||
Physicochemical properties | |||
Number of amino acids: | 267 | ||
Molecular weight: | 11,133.758 | ||
Theoretical pI: | 11.766 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 103.855 | ||
aromaticity | 0.051 | ||
GRAVY | -0.516 | ||
Secondary Structure Fraction | |||
Helix | 0.263 | ||
turn | 0.354 | ||
sheet | 0.232 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646094.1 | 5prime_partial | 99 | 2-301(+) |
Amino Acid sequence : | |||
LNAKFTYGVSSLVLPLLLSSLPHQVSFWHQKTLPTEPSRRHPHRRPPPASVHSSPPDFADSLPTIRSISLPPARLPASPSPLLPCRNRRMHQQERLGLR* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,133.758 | ||
Theoretical pI: | 11.766 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 103.855 | ||
aromaticity | 0.051 | ||
GRAVY | -0.516 | ||
Secondary Structure Fraction | |||
Helix | 0.263 | ||
turn | 0.354 | ||
sheet | 0.232 |