Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646114.1 | internal | 268 | 1-804(+) |
Amino Acid sequence : | |||
QRRGEDVIHPLKVSLEDLYSGTSKKLSLSRNVICSKCNGKGSKSGASMKCHGCQGSGIKVSIRQLGPSMIQQMQHACNECKGTGETINDKDRCPLCKGEKVVQEKKVLEVIVEKGMQNGQ KITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFYEHTLSLTEALCGFQFVLTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPIYQRPFMRGKLYIHFTVEFPDALTPEQCKAL EAVLPARTSSQLTDMELDECEETTLHDV | |||
Physicochemical properties | |||
Number of amino acids: | 268 | ||
Molecular weight: | 29,854.933 | ||
Theoretical pI: | 6.281 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6585 | ||
Instability index: | 24.764 | ||
aromaticity | 0.052 | ||
GRAVY | -0.488 | ||
Secondary Structure Fraction | |||
Helix | 0.257 | ||
turn | 0.213 | ||
sheet | 0.235 |