Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646128.1 | 3prime_partial | 255 | 88-852(+) |
Amino Acid sequence : | |||
MASNGEGNAEFSFANGPAGTGWNGLAKIQTNRRHNGICHDDSTTPVKAQTIDELHSLQKKKSAPTTPIKDADGTFAIISEEERQKLQLQSISASLASLTRETGPKLVRGDPARKVEAAKV SNVVDYIPAISVSDSSLKSTHVLYNLSPAELYEQAIKYEKGSFITSTGALATLSGAKTGRSPRDKRVVRDEATEDELWWGKGSPNIEMDEHTFLVNRERAVDYLNSLDKVFVNDQFLNWD PEHRIKVRIVSARAL | |||
Physicochemical properties | |||
Number of amino acids: | 255 | ||
Molecular weight: | 28,050.046 | ||
Theoretical pI: | 6.612 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29450 | ||
Instability index: | 32.320 | ||
aromaticity | 0.063 | ||
GRAVY | -0.546 | ||
Secondary Structure Fraction | |||
Helix | 0.259 | ||
turn | 0.251 | ||
sheet | 0.251 |