Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646130.1 | complete | 178 | 291-827(+) |
Amino Acid sequence : | |||
MLADQMITRIEYVHSKGFLHRDIKPDNFLMGLGRKANQVYIIDFGLAKRYRDSTSNRHIPYRENKNLTGTARYASCNTHLGIEQSRRDDLESLGYVLLYFLRGSLPWQGLKAATKKQKYD KICEKKLSTPIEVLCKSHPVEFASYFHYCHSLTFDQRPDYGFLKRLFRDLFTREAYDF* | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 20,989.816 | ||
Theoretical pI: | 9.390 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23630 | ||
Instability index: | 38.453 | ||
aromaticity | 0.135 | ||
GRAVY | -0.570 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.185 | ||
sheet | 0.225 |