Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646132.1 | 5prime_partial | 240 | 3-725(+) |
Amino Acid sequence : | |||
GIGRAIALHLASLGANLVINYASSSTQADLLVSDLNSSASSSHRRAIAIQADVSDSDQVKSLFDRAEQAFGSPIHILVNSAGILDPKYPTVATTAVEDWESTFNVNAKGAFLCCREAANR IKRGGCGRIIAVSSSVVAGLYPGYAAYAASKAAVETMIKILAKELKGTGITANCVAPGPVATEMFFAGKSEETVKRLVDGCPLGRLGEPKDIAPVVGFIASDAGEWVNGQVIRVNGGSVI * | |||
Physicochemical properties | |||
Number of amino acids: | 240 | ||
Molecular weight: | 16,280.498 | ||
Theoretical pI: | 11.164 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 42.826 | ||
aromaticity | 0.093 | ||
GRAVY | -0.709 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.314 | ||
sheet | 0.157 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646132.1 | 5prime_partial | 140 | 821-399(-) |
Amino Acid sequence : | |||
QGFQGNVLKVIFIHTNHKLLNLKKKYRFGAYLLYNRATINPDDLPINPFTSITCYESNNRSNILGLPKSPQRTPINQSLHSFLRLPRKEHLSSNRPWCHTIRSYPRALQLFRKNLDHSFN SGLGRRVRSVTRVKPSDNGR* | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 16,280.498 | ||
Theoretical pI: | 11.164 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 42.826 | ||
aromaticity | 0.093 | ||
GRAVY | -0.709 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.314 | ||
sheet | 0.157 |