Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646134.1 | 3prime_partial | 254 | 37-798(+) |
Amino Acid sequence : | |||
MPIESSIPTPLGPAACEKDAKALQFIEEMTINADPVQEKVLAEILSRNAKTEYLRRYHLDGATDRHNFKSKVPVITYEDLQPEIQRIANGDRTSILSADPISEFLTSSGTSAGERKLMPT IQEELDRRQVLYSLLMPVMNLYVPGLDKGKGLYFLFIKSETKTPGGLVARPVLTSYYKSDHFKARPYDPYMVYTSPNEAILCTDSYQSMYTQMFRGLYHREEVLRVGAVFASGLLRAIRF LQLNWQQLADDIAS | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 28,768.635 | ||
Theoretical pI: | 6.130 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26485 | ||
Instability index: | 56.804 | ||
aromaticity | 0.094 | ||
GRAVY | -0.293 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.217 | ||
sheet | 0.283 |