Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646138.1 | internal | 227 | 3-683(+) |
Amino Acid sequence : | |||
YLSLSLSLSLSLSLSLSPSSPFMDSSSGNLVFKDSSWWLFTLPAFFGTKTLSPHDHHTFLLLLSLFLAFIALSLLTWALSSGGSAWKHGRNHKGLVPITGPRGLPVFGTLFALSHGLPHR TLAAMARTMTQTTQQLMAFSLGSSPAVVTSDPHIAREILTSADFADRPLKQSAQDLMFNRAIGFAPNGTYWRFLRRIASSHLFAPKRIMAHEARRQIDCDAMVSAVA | |||
Physicochemical properties | |||
Number of amino acids: | 227 | ||
Molecular weight: | 24,827.431 | ||
Theoretical pI: | 10.400 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
Instability index: | 47.073 | ||
aromaticity | 0.101 | ||
GRAVY | 0.204 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.269 | ||
sheet | 0.300 |