Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646158.1 | internal | 266 | 2-799(+) |
Amino Acid sequence : | |||
FNKTTSSPMAATVLLLGLFLASLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSQQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVG NEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRN LFDALVDSVYASLEKAGGGGLEIVVS | |||
Physicochemical properties | |||
Number of amino acids: | 266 | ||
Molecular weight: | 29,284.143 | ||
Theoretical pI: | 8.948 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 46.606 | ||
aromaticity | 0.098 | ||
GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
Helix | 0.361 | ||
turn | 0.297 | ||
sheet | 0.214 |