Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646162.1 | complete | 222 | 50-718(+) |
Amino Acid sequence : | |||
MADEVVLLNFWPSPFAMRVGMALELKQINYEIKEEDLQNKSDLLLQMNPIHKKVPVLIHNGKPICESLLILQYIDETWNNKAPLLLPSDPYERAVARFWADYIDKKILDCVRKICFTKAD DGAREEGRTELMECLKLLEGELGDKPYFGGEEMGLVDIVALSFYAWFYCMETFGKFSLEVEFPKLIGLGKKCMEKESVNKIIPDGNKIYEYVLARRKSAGLD* | |||
Physicochemical properties | |||
Number of amino acids: | 222 | ||
Molecular weight: | 25,525.512 | ||
Theoretical pI: | 5.113 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35785 | ||
Instability index: | 41.688 | ||
aromaticity | 0.104 | ||
GRAVY | -0.169 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.189 | ||
sheet | 0.320 |